PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10028458m
Common NameCARUB_v10028458mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 436aa    MW: 48988.6 Da    PI: 7.6903
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10028458mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-18107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +l+++vkq+G + W++I++++  gR +kqc++rw+++l
  Carubv10028458m 107 KGQWTAEEDRKLIRLVKQHGERKWALISEKLE-GRAGKQCRERWHNHL 153
                      799*****************************.*************97 PP

2Myb_DNA-binding45.51.8e-14160201245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + W++eE+  lv+ + + G++ W+ Ia+ ++ gRt++++k++w+
  Carubv10028458m 160 DGWSEEEEMVLVESHMRIGNK-WAEIAKLIP-GRTENSIKNHWN 201
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.467102157IPR017930Myb domain
SuperFamilySSF466893.48E-29104200IPR009057Homeodomain-like
SMARTSM007178.5E-17106155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-27108160IPR009057Homeodomain-like
CDDcd001678.53E-16110153No hitNo description
PfamPF139219.5E-20110168No hitNo description
PROSITE profilePS5129415.002158208IPR017930Myb domain
SMARTSM007173.2E-13158206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-19161206IPR009057Homeodomain-like
CDDcd001676.46E-10162204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MEDSCLLHGA APPLTAVERF LYGQKNDALC SKKGECSRDR PIVKTKMSMI ETRSNNKENT  60
TFGQTREKHL VLNGANRSPI GQVVPIKSAA RYSQNSTKKR PYKNLIKGQW TAEEDRKLIR  120
LVKQHGERKW ALISEKLEGR AGKQCRERWH NHLRPDIKKD GWSEEEEMVL VESHMRIGNK  180
WAEIAKLIPG RTENSIKNHW NATKRRQNSK RKHKHKRESN ADTNDSDVSP SAKRPCILQD  240
YIKSIDNNGI YKNDDENKNE NTISVISTPN LDRLIYSDGD SASSILGDPY DEELVYLQNI  300
FANHLISLEN IGLTQTSDEV TQPSSSAFVI NTPNLNLDNN VGTHHQEATI AAPANTSHLA  360
SDIYLSYLLN GTTSSYLDTH FPSSSSSTSS TTVEHVGHNE FLEPQANSTS ERREMDLIEM  420
LSGSIQGSNI CFPSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-441052072104C-Myb DNA-Binding Domain
1msf_C8e-441052072104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210217RKHKHKRE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719780.0AF371978.1 Arabidopsis thaliana putative transcription factor MYB119 (MYB119) mRNA, complete cds.
GenBankDQ4470910.0DQ447091.1 Arabidopsis thaliana clone pENTR221-At5g58850 myb family transcription factor (At5g58850) mRNA, complete cds.
GenBankDQ6533800.0DQ653380.1 Arabidopsis thaliana clone 0000013309_0000009608 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282192.10.0hypothetical protein CARUB_v10028458mg
TrEMBLR0GRY00.0R0GRY0_9BRAS; Uncharacterized protein
STRINGAT5G58850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.10.0myb domain protein 119